Alternative Name(s):

PRO1284; SBBI31; SNX24; SNX24_HUMAN; Sorting nexin 24; Sorting nexin-24; Sorting nexing 24; UNQ654

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SNX24

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Expression Region:

1-169aa

Subcellular Location:

Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

35.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Transport

Function:

May be involved in several stages of intracellular trafficking.

Involvement in disease:

Relevance:

May be involved in several stages of intracellular trafficking.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Sorting nexin family

Reference:

N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)