Recombinant Human Sperm mitochondrial-associated cysteine-rich protein(SMCP) CSB-EP021820HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
HSMCSGEN1 ; MCS ; MCSP ; MCSP_HUMAN; Mitochondrial capsule selenoprotein; SMCP; Sperm mitochondria associated cysteine rich protein; Sperm mitochondrial-associated cysteine-rich protein
Species: (Organism)
Homo sapiens (Human)
Gene Names:
SMCP
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Expression Region:
1-116aa
Subcellular Location:
Cytoplasm, Mitochondrion membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity:
Testis. Is selectively expressed in the spermatids of seminiferous tubules.
Protein Length:
Full Length
Pathway:
Mol. Weight:
39.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Developmental Biology
Function:
Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity).
Involvement in disease:
Relevance:
Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP).Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190(1996)
