Alternative Name(s):

Carnitine/acylcarnitine translocase

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SLC25A20

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL

Expression Region:

1-301aa

Subcellular Location:

Mitochondrion inner membrane, Multi-pass membrane protein

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

59.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Involvement in disease:

Carnitine-acylcarnitine translocase deficiency (CACTD)

Relevance:

Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Mitochondrial carrier (TC 2.A.29) family

Reference:

"The structure and organization of the human carnitine/acylcarnitine translocase (CACT) gene." Iacobazzi V., Naglieri M.A., Stanley C.A., Wanders R.J.A., Palmieri F. Biochem. Biophys. Res. Commun. 252:770-774(1998)