Alternative Name(s):

Pulmonary surfactant-associated proteolipid SPL(Val) SP5

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SFTPC

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Expression Region:

24-58aa

Subcellular Location:

Secreted, extracellular space, surface film

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

30.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Involvement in disease:

Pulmonary surfactant metabolism dysfunction 2 (SMDP2); Respiratory distress syndrome in premature infants (RDS)

Relevance:

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Low molecular weight human pulmonary surfactant protein (SP5): isolation, characterization, and cDNA and amino acid sequences."Warr R.G., Hawgood S., Buckley D.I., Crisp T.M., Schilling J., Benson B.J., Ballard P.L., Clements J.A., White R.T.Proc. Natl. Acad. Sci. U.S.A. 84:7915-7919(1987)