Alternative Name(s):

Calcyclin;Growth factor-inducible protein 2A9MLN 4Prolactin receptor-associated protein ;PRAS100 calcium-binding protein A6

Species: (Organism)

Homo sapiens (Human)

Gene Names:

S100A6

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Expression Region:

1-90aa

Subcellular Location:

Nucleus envelope, Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

26.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Involvement in disease:

Relevance:

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

S-100 family

Reference:

Molecular cloning of the cDNA for a growth factor-inducible gene with strong homology to S-100, a calcium-binding protein.Calabretta B., Battini R., Kaczmarek L., de Riel J.K., Baserga R.J. Biol. Chem. 261:12628-12632(1986)