Alternative Name(s):

Protein S-100E S100 calcium-binding protein A3

Species: (Organism)

Homo sapiens (Human)

Gene Names:

S100A3

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Expression Region:

1-101aa

Subcellular Location:

Cytoplasm

Tissue Specificity:

Skin specific, specifically expressed at the inner endocuticle of hair fibers.

Protein Length:

Full Length

Pathway:

Mol. Weight:

38.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

Involvement in disease:

Relevance:

Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

S-100 family

Reference:

"Six S100 genes are clustered on human chromosome 1q21: identification of two genes coding for the two previously unreported calcium-binding proteins S100D and S100E." Engelkamp D., Schaefer B.W., Mattei M.-G., Erne P., Heizmann C.W. Proc. Natl. Acad. Sci. U.S.A. 90:6547-6551(1993)