Recombinant Human Protein S100-A1(S100A1) CSB-EP020622HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
S-100 protein alpha chain;S-100 protein subunit alpha;S100 calcium-binding protein A1
Species: (Organism)
Homo sapiens (Human)
Gene Names:
S100A1
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Expression Region:
2-94aa
Subcellular Location:
Cytoplasm
Tissue Specificity:
Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
26.4 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
Probably acts as a Ca(2+) signal transducer
Involvement in disease:
Relevance:
Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
S-100 family
Reference:
S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264(1992)
