Alternative Name(s):

Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor

Species: (Organism)

Homo sapiens (Human)

Gene Names:

RYR3

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV

Expression Region:

3934-4181aa

Subcellular Location:

Sarcoplasmic reticulum membrane, Multi-pass membrane protein, Membrane, Multi-pass membrane protein, Microsome membrane, Multi-pass membrane protein, Sarcoplasmic reticulum

Tissue Specificity:

Brain, skeletal muscle, placenta and possibly liver and kidney. In brain, highest levels are found in the cerebellum, hippocampus, caudate nucleus and amygdala, with lower levels in the corpus callosum, substantia nigra and thalamus.

Protein Length:

Partial

Pathway:

Calciumsignalingpathway

Mol. Weight:

32.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca(2+) release by other calcium channels. Calcium channel that mediates Ca(2+)-induced Ca(2+) release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis (By similarity). Plays a role in cellular calcium signaling.

Involvement in disease:

Relevance:

Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Ryanodine receptor (TC 1.A.3.1) family, RYR3 subfamily

Reference:

Characterization of the binding sites for the interactions between FKBP12 and intracellular calcium release channels.Wen H., Kang S., Song Y., Song Y., Yang H.J., Kim M.H., Park S.Arch. Biochem. Biophys. 517:37-42(2012)