Alternative Name(s):

CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

RNF7

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Expression Region:

2-113aa

Subcellular Location:

Cytoplasm, Nucleus

Tissue Specificity:

Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.

Protein Length:

Full Length of Mature Protein

Pathway:

Ubiquitinmediatedproteolysis

Mol. Weight:

39.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription

Involvement in disease:

Relevance:

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

RING-box family

Reference:

Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748(1999)