Recombinant Human Non-secretory ribonuclease(RNASE2) CSB-EP019794HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ;RNase 2Ribonuclease US
Species: (Organism)
Homo sapiens (Human)
Gene Names:
RNASE2
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Expression Region:
28-161aa
Subcellular Location:
Lysosome, Cytoplasmic granule
Tissue Specificity:
Liver, lung, spleen, leukocytes and body fluids.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
19.5 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Involvement in disease:
Relevance:
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Pancreatic ribonuclease family
Reference:
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
