Recombinant Human Phosphoserine phosphatase(PSPH) CSB-EP018938HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
L-3-phosphoserine phosphatase O-phosphoserine phosphohydrolase
Species: (Organism)
Homo sapiens (Human)
Gene Names:
PSPH
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Expression Region:
1-225aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
52 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.
Involvement in disease:
Phosphoserine phosphatase deficiency (PSPHD)
Relevance:
Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
HAD-like hydrolase superfamily, SerB family
Reference:
"Human L-3-phosphoserine phosphatase: sequence, expression and evidence for a phosphoenzyme intermediate." Collet J.-F., Gerin I., Rider M.H., Veiga-Da-Cunha M., Van Schaftingen E. FEBS Lett. 408:281-284(1997)
