Alternative Name(s):

PLA2P (PLAP) (Plap)

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Plaa

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC

Expression Region:

495-584aa

Subcellular Location:

Nucleus, Cytoplasm, Cell junction, synapse

Tissue Specificity:

Expressed in the brain, with highest levels in hippocampal neurons, cerebellar granular cell layer and Purkinje cells (PubMed:28413018).

Protein Length:

Partial

Pathway:

Mol. Weight:

14.7 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Plays a role in protein ubiquitination, sorting and degradation through its association with VCP (By similarity). Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling

Involvement in disease:

Relevance:

Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha- or lipopolysaccharide-dependent manner, and hence prostaglandin E2 biosynthesis.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

WD repeat PLAP family

Reference:

"Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development." Ko M.S.H., Kitchen J.R., Wang X., Threat T.A., Wang X., Hasegawa A., Sun T., Grahovac M.J., Kargul G.J., Lim M.K., Cui Y., Sano Y., Tanaka T.S., Liang Y., Mason S., Paonessa P.D., Sauls A.D., DePalma G.E. Doi H. Development 127:1737-1749(2000)