Alternative Name(s):

PIGR; Polymeric immunoglobulin receptor; PIgR; Poly-Ig receptor) [Cleaved into: Secretory component]

Species: (Organism)

Bos taurus (Bovine)

Gene Names:

PIGR

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS

Expression Region:

400-599aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Secretory component: Secreted

Tissue Specificity:

Found in mammary gland, jejunum, lung, kidney and small intestine.

Protein Length:

Partial

Pathway:

Mol. Weight:

26.0 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.

Involvement in disease:

Relevance:

This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Cloning and characterization of two forms of bovine polymeric immunoglobulin receptor cDNA.Kulseth M.A., Krajci P., Myklebost O., Rogne S.DNA Cell Biol. 14:251-256(1995)