Alternative Name(s):

B-cell receptor-associated protein 32 (BAP 32)

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Phb

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD

Expression Region:

1-40aa

Subcellular Location:

Mitochondrion inner membrane

Tissue Specificity:

Widely expressed in different tissues.

Protein Length:

Partial

Pathway:

Mol. Weight:

8.1 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).

Involvement in disease:

Relevance:

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Prohibitin family

Reference:

"Mammalian prohibitin proteins respond to mitochondrial stress and decrease during cellular senescence." Coates P.J., Nenutil R., McGregor A., Picksley S.M., Crouch D.H., Hall P.A., Wright E.G. Exp. Cell Res. 265:262-273(2001)