Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5) CSB-EP017644MO
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Proprotein convertase 5 ;PC5Proprotein convertase 6 ;PC6Subtilisin-like proprotein convertase 6 ;SPC6Subtilisin/kexin-like protease PC5
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Pcsk5
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE
Expression Region:
117-452aa
Subcellular Location:
Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein
Tissue Specificity:
PC5A is expressed in most tissues but is most abundant in the intestine and adrenals. PC5B is expressed in the intestine, adrenals and lung but not in the brain.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
52.7 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.
Involvement in disease:
Relevance:
Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Peptidase S8 family
Reference:
Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993)
