Recombinant Human Nuclear pore membrane glycoprotein 210(NUP210),partial CSB-EP016195HU(C)
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Nuclear envelope pore membrane protein POM 210 ;POM210Nucleoporin Nup210Pore membrane protein of 210KDA
Species: (Organism)
Homo sapiens (Human)
Gene Names:
NUP210
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Expression Region:
1529-1808aa
Subcellular Location:
Nucleus, nuclear pore complex, Nucleus membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein
Tissue Specificity:
Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle.
Protein Length:
Partial
Pathway:
Mol. Weight:
34.5 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Transport
Function:
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.
Involvement in disease:
Relevance:
Nucleoporin essential for nuclear pore assbly and fusion, nuclear pore spacing, as well as structural integrity.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
NUP210 family
Reference:
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
