Alternative Name(s):

28S ribosomal protein S32, mitochondrial ;MRP-S32 ;S32mt39S ribosomal protein L31, mitochondrial ;L31mt ;MRP-L31

Species: (Organism)

Homo sapiens (Human)

Gene Names:

MRPL42

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

Expression Region:

33-142aa

Subcellular Location:

Mitochondrion

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

40.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Involvement in disease:

Relevance:

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Mitochondrion-specific ribosomal protein mL42 family

Reference:

Mao Y.F., Peng Y., Dai M., Huang Q.H., Song H., Zhang Q.H., Mao M., Fu G., Luo M., Chen J.H., Hu R. Isolating a new human cDNA.Chen J.H., Luo W.Q., Hu S.N., Li G.T., Jin J., Huang X.W., Zhou H.J., Yuan J.G., Qiang B.Q.Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)