Recombinant Human PCNA-associated factor(PCLAF) CSB-EP012164HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Hepatitis C virus NS5A-transactivated protein 9 ;HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ;OEATC-1;PCNA-associated factor of 15KDA ;PAF15 ;p15PAF
Species: (Organism)
Homo sapiens (Human)
Gene Names:
PCLAF
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Expression Region:
1-111aa
Subcellular Location:
Nucleus, Cytoplasm, perinuclear region
Tissue Specificity:
Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas, adrenocortical carcinomas, and in non-small-cell lung cancer lines.
Protein Length:
Full Length
Pathway:
InflammatoryPain
Mol. Weight:
39 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Metabolism
Function:
PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Involvement in disease:
Relevance:
PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer.Jain M., Zhang L., Patterson E.E., Kebebew E.PLoS ONE 6:E26866-E26866(2011)
