Alternative Name(s):

JTB; Protein JTB

Species: (Organism)

Brugia malayi (Filarial nematode worm)

Gene Names:

JTB

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL

Expression Region:

31-105aa

Subcellular Location:

Membrane, Single-pass type I membrane protein, Mitochondrion, Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, spindle

Tissue Specificity:

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

24.4 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly (By similarity).

Involvement in disease:

Relevance:

Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

JTB family

Reference:

"JTB: a novel membrane protein gene at 1q21 rearranged in a jumping translocation."Hatakeyama S., Osawa M., Omine M., Ishikawa F.Oncogene 18:2085-2090(1999)