Alternative Name(s):

Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog

Species: (Organism)

Homo sapiens (Human)

Gene Names:

IRGM

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Expression Region:

1-181aa

Subcellular Location:

Golgi apparatus membrane, Cell membrane, Cytoplasmic vesicle, phagosome membrane, Cytoplasmic vesicle, autophagosome membrane, Cell projection, phagocytic cup

Tissue Specificity:

Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.

Protein Length:

Full Length

Pathway:

Mol. Weight:

47.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).

Involvement in disease:

Inflammatory bowel disease 19 (IBD19)

Relevance:

Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TRAFAC class dynamin-like GTPase superfamily, IRG family

Reference:

"Death and resurrection of the human IRGM gene." Bekpen C., Marques-Bonet T., Alkan C., Antonacci F., Leogrande M.B., Ventura M., Kidd J.M., Siswara P., Howard J.C., Eichler E.E. PLoS Genet. 5:E1000403-E1000403(2009)