Alternative Name(s):

CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name: IL-8R B IL-8 receptor type 2 CD_antigen: CD182

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CXCR2

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE

Expression Region:

1-40aa

Subcellular Location:

Cell membrane, Multi-pass membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Chemokinesignalingpathway

Mol. Weight:

20.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Involvement in disease:

Relevance:

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

G-protein coupled receptor 1 family

Reference:

"Cloning of complementary DNA encoding a functional human interleukin-8 receptor."Murphy P.M., Tiffany H.L.Science 253:1280-1283(1991)