Alternative Name(s):

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8

Species: (Organism)

Canis lupus familiaris (Dog) (Canis familiaris)

Gene Names:

IL8

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP

Expression Region:

23-101aa

Subcellular Location:

Secreted

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

36.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Involvement in disease:

Relevance:

IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Intercrine alpha (chemokine CxC) family

Reference:

Borrelia burgdorferi migrates into joint capsules and causes an up-regulation of interleukin-8 in synovial membranes of dogs experimentally infected with ticks.Straubinger R.K., Straubinger A.F., Harter L., Jacobson R.H., Chang Y.-F., Summers B.A., Erb H.N., Appel M.J.Infect. Immun. 65:1273-1285(1997)