Alternative Name(s):

General transcription factor IIA subunit 2 TFIIA p12 subunit

Species: (Organism)

Homo sapiens (Human)

Gene Names:

GTF2A2

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Expression Region:

1-109aa

Subcellular Location:

Nucleus

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

39.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Involvement in disease:

Relevance:

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TFIIA subunit 2 family

Reference:

"Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription." Sun X., Ma D., Sheldon M., Yeung K., Reinberg D. Genes Dev. 8:2336-2348(1994)