Alternative Name(s):

Transducin alpha-2 chain

Species: (Organism)

Bos taurus (Bovine)

Gene Names:

GNAT2

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF

Expression Region:

2-354aa

Subcellular Location:

Tissue Specificity:

Retinal rod outer segment.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

44 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.

Involvement in disease:

Relevance:

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

G-alpha family, G(i/o/t/z) subfamily

Reference:

"Sequence of the alpha subunit of photoreceptor G protein: homologies between transducin, ras, and elongation factors." Lochrie M.A., Hurley J.B., Simon M.I. Science 228:96-99(1985)