Alternative Name(s):

GLI family zinc finger protein 2 Tax helper protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

GLI2

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Expression Region:

412-641aa

Subcellular Location:

Nucleus, Cytoplasm, Cell projection, cilium

Tissue Specificity:

Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (PubMed:9557682). Isoform 3 and isoform 4 are weakly expressed in HTLV-1-infected T-cell lines (PubMed:9557682).

Protein Length:

Partial

Pathway:

Hedgehogsignalingpathway

Mol. Weight:

42.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Functions as transcription regulator in the hedgehog (Hh) pathway

Involvement in disease:

Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)

Relevance:

Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

GLI C2H2-type zinc-finger protein family

Reference:

"Novel heterozygous nonsense GLI2 mutations in patients with hypopituitarism and ectopic posterior pituitary lobe without holoprosencephaly."Franca M.M., Jorge A.A., Carvalho L.R., Costalonga E.F., Vasques G.A., Leite C.C., Mendonca B.B., Arnhold I.J.J. Clin. Endocrinol. Metab. 95:E384-E391(2010) .