Alternative Name(s):

Somatotropin receptor

Species: (Organism)

Macaca mulatta (Rhesus macaque)

Gene Names:

GHR

Tag info:

C-terminal 6xHis-tagged

Target Protein AA Sequence:

FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Expression Region:

19-264aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

30.2 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway (By similarity).

Involvement in disease:

Relevance:

Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Type I cytokine receptor family, Type 1 subfamily

Reference:

"Monkey growth hormone (GH) receptor gene expression. Evidence for two mechanisms for the generation of the GH binding protein." Martini J.-F., Pezet A., Guezennec C.Y., Edery M., Postel-Vinay M.-C., Kelly P.A. J. Biol. Chem. 272:18951-18958(1997)