Alternative Name(s):

Astrocyte-derived trophic factor ;ATF

Species: (Organism)

Homo sapiens (Human)

Gene Names:

GDNF

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Expression Region:

78-211aa

Subcellular Location:

Secreted

Tissue Specificity:

In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic islets. Isoform 5 is expressed at very low levels in putamen, nucleus accumbens, prefrontal cortex, amygdala, hypothalamus and intestine. Isoform 3 is up-regulated in the middle temporal gyrus of Alzheimer disease patients while isoform 2 shows no change.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

31.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Involvement in disease:

Hirschsprung disease 3 (HSCR3); Congenital central hypoventilation syndrome (CCHS); Pheochromocytoma (PCC)

Relevance:

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TGF-beta family, GDNF subfamily

Reference:

GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)