Alternative Name(s):

FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Species: (Organism)

Homo sapiens (Human)

Gene Names:

FXYD2

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Expression Region:

1-64aa

Subcellular Location:

Membrane, Single-pass type III membrane protein

Tissue Specificity:

Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Protein Length:

Full Length of Isoform 2

Pathway:

cAMPsignalingpathway

Mol. Weight:

34.4 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Involvement in disease:

Hypomagnesemia 2 (HOMG2)

Relevance:

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

FXYD family

Reference:

"Dominant isolated renal magnesium loss is caused by misrouting of the Na+,K+-ATPase gamma-subunit." Meij I.C., Koenderink J.B., van Bokhoven H., Assink K.F.H., Groenestege W.T., de Pont J.J.H.H.M., Bindels R.J.M., Monnens L.A.H., van den Heuvel L.P.W.J., Knoers N.V.A.M. Nat. Genet. 26:265-266(2000)