Recombinant Mouse fMet-Leu-Phe receptor(Fpr1),partial CSB-EP008854MO1
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Fpr1
Tag info:
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Target Protein AA Sequence:
MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV
Expression Region:
1-35aa
Subcellular Location:
Cell membrane, Multi-pass membrane protein
Tissue Specificity:
Expressed in neutrophils, dendritic cells, microglia, spleen, lung and liver. Low level of expression in the vomeronasal organ.
Protein Length:
Partial
Pathway:
Mol. Weight:
33.7 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Involvement in disease:
Relevance:
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
G-protein coupled receptor 1 family
Reference:
"Species and subtype variants of the N-formyl peptide chemotactic receptor reveal multiple important functional domains." Gao J.-L., Murphy P.M. J. Biol. Chem. 268:25395-25401(1993)
