Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R) CSB-EP008789HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Folate receptor 4 Folate receptor delta Short name: FR-delta IZUMO1 receptor protein JUNO
Species: (Organism)
Homo sapiens (Human)
Gene Names:
IZUMO1R
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
Expression Region:
20-250aa
Subcellular Location:
Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Endocytosis
Mol. Weight:
30.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Developmental Biology
Function:
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for species-specific gamete recognition and fertilization. The IZUMO1
Involvement in disease:
Relevance:
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate (By similarity).
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Folate receptor family
Reference:
"Juno is the egg Izumo receptor and is essential for mammalian fertilization."Bianchi E., Doe B., Goulding D., Wright G.J.Nature 508:483-487(2014)
