Alternative Name(s):

25KDA FK506-binding protein ;25KDA FKBP ;FKBP-25FK506-binding protein 3 ;FKBP-3Immunophilin FKBP25Rapamycin-selective 25KDA immunophilinRotamase

Species: (Organism)

Homo sapiens (Human)

Gene Names:

FKBP3

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Expression Region:

2-224aa

Subcellular Location:

Nucleus

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

41 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.

Involvement in disease:

Relevance:

FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

FKBP-type PPIase family

Reference:

Isolation of a human cDNA encoding a 25KDA FK-506 and rapamycin binding protein.Wiederrecht G., Martin M., Sigal N., Siekierka J.J.Biochem. Biophys. Res. Commun. 185:298-303(1992)