Alternative Name(s):

FGF-1 intracellular-binding protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

FIBP

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Expression Region:

2-357aa

Subcellular Location:

Nucleus, Endomembrane system, Peripheral membrane protein

Tissue Specificity:

Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.

Protein Length:

Full Length of Isoform Short

Pathway:

Mol. Weight:

57.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).

Involvement in disease:

Thauvin-Robinet-Faivre syndrome (TROFAS)

Relevance:

May be involved in mitogenic function of FGF1.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.Kolpakova E., Wiedlocha A., Stenmark H., Klingenberg O., Falnes P.O., Olsnes S.Biochem. J. 336:213-222(1998)