Recombinant Human Low affinity immunoglobulin epsilon Fc receptor(FCER2),partial CSB-EP008534HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
BLAST-2;C-type lectin domain family 4 member JFc-epsilon-RIIImmunoglobulin E-binding factorLymphocyte IgE receptor; CD23
Species: (Organism)
Homo sapiens (Human)
Gene Names:
FCER2
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Expression Region:
48-321aa
Subcellular Location:
Cell membrane, Single-pass type II membrane protein, Cell membrane, Lipid-anchor, Secreted
Tissue Specificity:
Protein Length:
Extracellular Domain
Pathway:
Hematopoieticcelllineage
Mol. Weight:
47 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Involvement in disease:
Relevance:
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia.Hersheson J., Mencacci N.E., Davis M., Macdonald N., Trabzuni D., Ryten M., Pittman A., Paudel R., Kara E., Fawcett K., Plagnol V., Bhatia K.P., Medlar A.J., Stanescu H.C., Hardy J., Kleta R., Wood N.W., Houlden H.Ann. Neurol. 73:546-553(2013)
