Alternative Name(s):

Dynactin complex subunit 22KDA subunit ;p22

Species: (Organism)

Homo sapiens (Human)

Gene Names:

DCTN3

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

Expression Region:

2-176aa

Subcellular Location:

Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Cleavage furrow, Midbody

Tissue Specificity:

Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.

Protein Length:

Full Length of Mature Protein of Isoform 2

Pathway:

Mol. Weight:

35.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Cycle

Function:

Together with dynein may be involved in spindle assembly and cytokinesis.

Involvement in disease:

Relevance:

Together with dynein may be involved in spindle assbly and cytokinesis.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Dynactin subunit 3 family

Reference:

Characterization of the p22 subunit of dynactin reveals the localization of Cytoplasmic domain dynein and dynactin to the midbody of dividing cells.Karki S., LaMonte B., Holzbaur E.L.F.J. Cell Biol. 142:1023-1034(1998)