Alternative Name(s):

CYC; CYC_HUMAN; CYCS; Cytochrome c; Cytochrome c somatic; HCS; THC4

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CYCS

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Expression Region:

2-105aa

Subcellular Location:

Mitochondrion intermembrane space

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

p53signalingpathway

Mol. Weight:

38.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Apoptosis

Function:

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; FUNCTION

Involvement in disease:

Thrombocytopenia 4 (THC4)

Relevance:

Electron carrier protein. The oxidized form of the cytochrome c he group can accept an electron from the he group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.Plays a role in apoptosis. Suppression of the anti-apoptotic mbers or activation of the pro-apoptotic mbers of the Bcl-2 family leads to altered mitochondrial mbrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Cytochrome c family

Reference:

The human somatic cytochrome c gene two classes of processed pseudogenes demarcate a period of rapid molecular evolution.Evans M.J., Scarpulla R.C.Proc. Natl. Acad. Sci. U.S.A. 85:9625-9629(1988)