Recombinant Human C-X-C chemokine receptor type 3(CXCR3),partial CSB-EP006253HU1
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
CKR-L2 (G protein-coupled receptor 9) (Interferon-inducible protein 10 receptor) (IP-10 receptor) (CD_antigen: CD183) (CXC-R3) (CXCR-3) (GPR9)
Species: (Organism)
Homo sapiens (Human)
Gene Names:
CXCR3
Tag info:
N-terminal 6xHis-GST-tagged
Target Protein AA Sequence:
EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Expression Region:
4-50aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Partial
Pathway:
Mol. Weight:
36.6 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cardiovascular
Function:
Involvement in disease:
Relevance:
Isoform 1: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.Isoform 2: Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"Activation of p38(MAPK) mediates the angiostatic effect of the chemokine receptor CXCR3-B." Petrai I., Rombouts K., Lasagni L., Annunziato F., Cosmi L., Romanelli R.G., Sagrinati C., Mazzinghi B., Pinzani M., Romagnani S., Romagnani P., Marra F. Int. J. Biochem. Cell Biol. 40:1764-1774(2008)
