Recombinant Rabbit Cathepsin K(Ctsk) CSB-EP006192RB
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Protein OC-2
Species: (Organism)
Oryctolagus cuniculus (Rabbit)
Gene Names:
Ctsk
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM
Expression Region:
115-329aa
Subcellular Location:
Lysosome
Tissue Specificity:
Predominantly expressed in osteclasts (bones).
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
27.6 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Involvement in disease:
Relevance:
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Peptidase C1 family
Reference:
Beta-substituted cyclohexanecarboxamide a nonpeptidic framework for the design of potent inhibitors of cathepsin K.Crane S.N., Black W.C., Palmer J.T., Davis D.E., Setti E., Robichaud J., Paquet J., Oballa R.M., Bayly C.I., McKay D.J., Somoza J.R., Chauret N., Seto C., Scheigetz J., Wesolowski G., Masse F., Desmarais S., Ouellet M.J. Med. Chem. 49:1066-1079(2006)
