Alternative Name(s):

Alpha(B)-crystallinHeat shock protein beta-5 ;HspB5Renal carcinoma antigen NY-REN-27Rosenthal fiber component

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CRYAB

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Expression Region:

1-175aa

Subcellular Location:

Cytoplasm, Nucleus

Tissue Specificity:

Lens as well as other tissues (PubMed:838078, PubMed:2387586). Expressed in myocardial tissue (PubMed:28493373).

Protein Length:

Full Length

Pathway:

Proteinprocessinginendoplasmicreticulum

Mol. Weight:

36.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Involvement in disease:

Myopathy, myofibrillar, 2 (MFM2); Cataract 16, multiple types (CTRCT16); Myopathy, myofibrillar, fatal infantile hypertonic, alpha-B crystallin-related (MFMFIH-CRYAB); Cardiomyopathy, dilated 1II (CMD1II)

Relevance:

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Small heat shock protein (HSP20) family

Reference:

The primary structure of the B2 chain of human alpha-crystallin.Kramps J.A., de Man B.M., de Jong W.W.FEBS Lett. 74:82-84(1977)