Alternative Name(s):

Clathrin light chain A; Clathrin light chain B; Clathrin light chain LCA; Clathrin light chain LCB; Clathrin light polypeptide A; Clathrin light polypeptide; Clathrin light polypeptide B; Clathrin light polypeptide LCA; Clathrin light polypeptide LCB; Clathrin; light chain (Lcb); Clathrin; light polypeptide (Lca); Clathrin; light polypeptide (Lcb); CLCA_HUMAN; CLTA; CLTB; Lca; LCB

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CLTA

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Expression Region:

1-218aa

Subcellular Location:

Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, spindle

Tissue Specificity:

Protein Length:

Full Length of Isoform Non-brain

Pathway:

Endocytosis

Mol. Weight:

50.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

Involvement in disease:

Relevance:

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Clathrin light chain family

Reference:

"Structure of human clathrin light chains. Conservation of light chain polymorphism in three mammalian species." Jackson A.P., Parham P. J. Biol. Chem. 263:16688-16695(1988)