Alternative Name(s):

ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CHRNA3

Tag info:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Expression Region:

32-240aa

Subcellular Location:

Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein

Tissue Specificity:

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

44.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Involvement in disease:

Relevance:

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily

Reference:

"Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor." Mihovilovic M., Roses A.D. Exp. Neurol. 111:175-180(1991)