Alternative Name(s):

CDC31 homolog; CEN 3; CEN3; Centrin EF hand protein 3; Centrin-3; Centrin3; CETN 3; Cetn3; CETN3_HUMAN; EF hand superfamily member; MGC12502; MGC138245

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CETN3

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI

Expression Region:

1-167aa

Subcellular Location:

Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, nucleolus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

46.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Tags & Cell Markers

Function:

Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION

Involvement in disease:

Relevance:

Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Centrin family

Reference:

"Identification of a new mammalian centrin gene, more closely related to Saccharomyces cerevisiae CDC31 gene." Middendorp S., Paoletti A., Schiebel E., Bornens M. Proc. Natl. Acad. Sci. U.S.A. 94:9141-9146(1997)