Alternative Name(s):

C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Cd82

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF

Expression Region:

111-227aa

Subcellular Location:

Membrane, Multi-pass membrane protein

Tissue Specificity:

Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

29.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Involvement in disease:

Relevance:

Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Tetraspanin (TM4SF) family

Reference:

The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)