Alternative Name(s):

26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ;Tspan-28; CD81

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CD81

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Expression Region:

113-201aa

Subcellular Location:

Basolateral cell membrane, Multi-pass membrane protein

Tissue Specificity:

Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.

Protein Length:

Extracellular Domain

Pathway:

Bcellreceptorsignalingpathway

Mol. Weight:

25.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION

Involvement in disease:

Immunodeficiency, common variable, 6 (CVID6)

Relevance:

May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Tetraspanin (TM4SF) family

Reference:

TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)