Alternative Name(s):

6Ckine;Beta-chemokine exodus-2;Secondary lymphoid-tissue chemokine ;SLC;Small-inducible cytokine A21

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CCL21

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Expression Region:

24-134aa

Subcellular Location:

Secreted

Tissue Specificity:

Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.

Protein Length:

Full Length of Mature Protein

Pathway:

Chemokinesignalingpathway

Mol. Weight:

39.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Involvement in disease:

Relevance:

Inhibits hopoiesis and stimulates chotaxis. Chotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Intercrine beta (chemokine CC) family

Reference:

Solution structure of CCL21 and identification of a putative CCR7 binding site.Love M., Sandberg J.L., Ziarek J.J., Gerarden K.P., Rode R.R., Jensen D.R., McCaslin D.R., Peterson F.C., Veldkamp C.T.Biochemistry 51:733-735(2012)