Alternative Name(s):

Chemokine CC-4 ;HCC-4;Chemokine LEC;IL-10-inducible chemokine;LCC-1;Liver-expressed chemokineLymphocyte and monocyte chemoattractant ;LMCMonotactin-1 ;MTN-1NCC-4;Small-inducible cytokine A16

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CCL16

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Expression Region:

24-120aa

Subcellular Location:

Secreted

Tissue Specificity:

Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.

Protein Length:

Full Length of Mature Protein

Pathway:

Chemokinesignalingpathway

Mol. Weight:

27.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

Involvement in disease:

Relevance:

Shows chotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Intercrine beta (chemokine CC) family

Reference:

Genomic organization of the genes for human and mouse CC chemokine LEC.Fukuda S., Hanano Y., Iio M., Miura R., Yoshie O., Nomiyama H.DNA Cell Biol. 18:275-283(1999)