Alternative Name(s):

Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CASP14

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY

Expression Region:

153-240aa

Subcellular Location:

Cytoplasm, Nucleus

Tissue Specificity:

Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only expressed at very low levels (PubMed:11175259). The p17/10 mature form is expressed in epidermis stratum corneum, the p20/p8 intermediate form in epidermis upper granular cells of the stratum granulosum (PubMed:22825846).

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

37.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum

Involvement in disease:

Ichthyosis, congenital, autosomal recessive 12 (ARCI12)

Relevance:

Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum . Ses to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin . In vitro has a preference for the substate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF . Involved in processing of prosaposin in the epidermis . May be involved in retinal pigment epithelium cell barrier function . Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Peptidase C14A family

Reference:

Multiple pathways are involved in DNA degradation during keratinocyte terminal differentiation.Yamamoto-Tanaka M., Makino T., Motoyama A., Miyai M., Tsuboi R., Hibino T.Cell Death Dis. 5:E1181-E1181(2014)