Alternative Name(s):

calcium/calmodulin-dependent protein kinase II inhibitor alpha ;mCaMKIINalpha

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Camk2n1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV

Expression Region:

1-78aa

Subcellular Location:

Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density

Tissue Specificity:

Brain specific (at protein level).

Protein Length:

Full Length

Pathway:

Mol. Weight:

24.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Potent and specific inhibitor of CaM-kinase II (CAMK2).

Involvement in disease:

Relevance:

Potent and specific inhibitor of CaM-kinase II (CAMK2).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

CAMK2N family

Reference:

Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)