Alternative Name(s):

CaM-like protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CALML3

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK

Expression Region:

1-149aa

Subcellular Location:

Tissue Specificity:

Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.

Protein Length:

Full Length

Pathway:

Calciumsignalingpathway

Mol. Weight:

43.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Tags & Cell Markers

Function:

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Involvement in disease:

Relevance:

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Calmodulin family

Reference:

"Down-regulation of a calmodulin-related gene during transformation of human mammary epithelial cells." Yaswen P., Smoll A., Peehl D.M., Trask D.K., Sager R., Stampfer M.R. Proc. Natl. Acad. Sci. U.S.A. 87:7360-7364(1990)