Alternative Name(s):

BT3A3_HUMAN; BTF3; BTN3A3; Butyrophilin subfamily 3 member A3

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BTN3A3

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Expression Region:

30-248aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Detected in peripheral blood mononuclear cells and in T-cells (at protein level). Detected in spleen and lymphocytes.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

39.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cardiovascular

Function:

Plays a role in T-cell responses in the adaptive immune response.

Involvement in disease:

Relevance:

Plays a role in T-cell responses in the adaptive immune response.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Immunoglobulin superfamily, BTN/MOG family

Reference:

A 1.1-Mb transcript map of the hereditary hemochromatosis locus.Ruddy D.A., Kronmal G.S., Lee V.K., Mintier G.A., Quintana L., Domingo R. Jr., Meyer N.C., Irrinki A., McClelland E.E., Fullan A., Mapa F.A., Moore T., Thomas W., Loeb D.B., Harmon C., Tsuchihashi Z., Wolff R.K., Schatzman R.C., Feder J.N.Genome Res. 7:441-456(1997)