Alternative Name(s):

BT3.2; BT3.3; BT3A2_HUMAN; BTF4; BTN3A 2; BTN3A2; Butyrophilin protein; Butyrophilin subfamily 3 member A2; Butyrophilin; subfamily 3; member A2; CD277; FLJ40011

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BTN3A2

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Expression Region:

30-248aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Detected in T-cells and natural killer cells.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

39.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Involvement in disease:

Relevance:

Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Immunoglobulin superfamily, BTN/MOG family

Reference:

The molecular basis for modulation of human Vgamma9Vdelta2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.Palakodeti A., Sandstrom A., Sundaresan L., Harly C., Nedellec S., Olive D., Scotet E., Bonneville M., Adams E.J.J. Biol. Chem. 287:32780-32790(2012)